LOGIN
Sale!
Semaglutide

Semaglutide

Price range: $90.00 through $175.00

Semaglutide is a synthetic analogue of Glucagon-Like Peptide-1 (GLP-1), a peptide involved in regulating glucose metabolism. It has been studied for its role in influencing insulin secretion and glucagon suppression in a glucose-dependent manner. Research has also explored its potential effects on appetite regulation, gastric emptying, and intestinal motility, as well as its broader implications for metabolic and cardiovascular pathways.

RESEARCH USE ONLY

These compounds are NOT intended for human consumption, clinical use, or veterinary applications. They are NOT FDA-approved. We are not affiliated with any pharmaceutical companies or their commercial medications. By placing an order, you certify these materials will be used exclusively for laboratory research only.

Chemical Formulation

Sequence

HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH₂

Molecular Formula

C187H291N45O59

Molecular Weight

4114 g/mol

PubChem CID

56843331

CAS Number

910463-68-2

Research Studies

The King of Ozempic Is Scared as Hell

This article from Wired delves into Novo Nordisk’s challenges in balancing its legacy of producing life-saving insulin with the blockbuster success of semaglutide drugs like Ozempic and Wegovy. It highlights the company’s concerns over market dynamics, production pressures, and ethical dilemmas in the U.S. healthcare market.
Explore Research

Ozempic 3.0? This Drug Causes the Greatest Weight Loss - By Far

Published by the New York Post, this article discusses retatrutide, a new drug that has demonstrated superior weight loss results compared to semaglutide. In clinical studies, obese adults using retatrutide lost up to 22% of their starting weight after 11 months. The article highlights the potential of retatrutide as a more effective treatment for obesity, though it notes that further research is needed to confirm these findings.
Explore Research

You ask, we answer

fREQUENTLY ASKED qUESTIONS

Absolutely. You can review our latest lab results on our Lab Results page. Our analytical testing is conducted by Janoshik Analytical, an independent third-party laboratory to verify the identity, purity, and composition of our research products. Each CoA includes purity analysis, peptide sequence confirmation, and date of analysis.

Coming Soon: We’re actively expanding our lab testing. Currently, we have complete analysis reports for Semaglutide, Tirzepatide, BPC-157, CJC-1295 (without DAC). Stay tuned – we’re working with Janoshik Analytical to complete testing for our entire product line.

Delivery typically takes 2-5 business days. We ship from right here in the USA to all US addresses.

Every package comes with professional packaging, tracking updates via email, and does not require a signature upon delivery.

Our peptides are shipping in lyophilized form, which is stable at room temperature during transit. Once received, store unopened vials in a cool, dry place.

After reconstitution, store between 2-8°C (36-46°F), keep refrigerated, avoid repeated freeze-thaw cycles, and protect from direct light.

Our peptides are shipped in lyophilized (freeze-dried) form, which ensures stability during transit. This powder form is highly stable at room temperature and resistant to temperature fluctuations that occur during shipping.

Research has shown no significant degradation or loss of purity when lyophilized peptides are exposed to room temperature during typical shipping timeframes. Each batch is verified for purity upon production, and our stability testing confirms maintenance of product integrity during standard shipping conditions.

For optimal long-term storage after receiving your order, we recommend storing the lyophilized peptides in a cool, dry place until reconstitution is needed.

For bulk inquiries and volume pricing, please email us at info@peakpeptides.com

Related Products

Melanotan II

$50.00

Kisspeptin

Price range: $50.00 through $80.00

Glutathione

Price range: $40.00 through $60.00

TB-500

Price range: $40.00 through $80.00

Navigation

popular

Get the Latest News

©2025 Peak Peptides. All rights reserved. Designed & Powered By Bizeebay SEO

LOGIN