Cagrilintide

$100.00

Cagrilintide is a long-acting analogue of amylin, a naturally occurring peptide that is co-released with insulin. It has been studied for its role in metabolic processes and its potential effects on liver function, cardiovascular systems, and cellular mechanisms. Research has also explored its use in combination with other compounds for enhancing metabolic pathways, with ongoing investigations into its broader biological functions.

RESEARCH USE ONLY

These compounds are NOT intended for human consumption, clinical use, or veterinary applications. They are NOT FDA-approved. We are not affiliated with any pharmaceutical companies or their commercial medications. By placing an order, you certify these materials will be used exclusively for laboratory research only.

Chemical Formulation

Sequence

XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP

Molecular Formula

C₁₉₄H₃₁₂N₅₄O₅₉S₂

Molecular Weight

4409.01 g/mol

PubChem CID

171397054

CAS Number

1415456-99-3

Research Studies

Once-Weekly Cagrilintide for Weight Management in People with Overweight and Obesity

This study evaluates the efficacy and safety of once-weekly cagrilintide injections in individuals with overweight and obesity, demonstrating significant reductions in body weight and good tolerability.

Cagrilintide: A Long-Acting Amylin Analog for the Treatment of Obesity

This article discusses cagrilintide as a long-acting amylin analog, highlighting its potential in combination with GLP-1 agonists like semaglutide for sustained weight loss in individuals with obesity.

You ask, we answer

fREQUENTLY ASKED qUESTIONS

Absolutely. You can review our latest lab results on our Lab Results page. Our analytical testing is conducted by Janoshik Analytical, an independent third-party laboratory to verify the identity, purity, and composition of our research products. Each CoA includes purity analysis, peptide sequence confirmation, and date of analysis.

Coming Soon: We’re actively expanding our lab testing. Currently, we have complete analysis reports for Semaglutide, Tirzepatide, BPC-157, CJC-1295 (without DAC). Stay tuned – we’re working with Janoshik Analytical to complete testing for our entire product line.

Delivery typically takes 2-5 business days. We ship from right here in the USA to all US addresses.

Every package comes with professional packaging, tracking updates via email, and does not require a signature upon delivery.

Our peptides are shipping in lyophilized form, which is stable at room temperature during transit. Once received, store unopened vials in a cool, dry place.

After reconstitution, store between 2-8°C (36-46°F), keep refrigerated, avoid repeated freeze-thaw cycles, and protect from direct light.

Our peptides are shipped in lyophilized (freeze-dried) form, which ensures stability during transit. This powder form is highly stable at room temperature and resistant to temperature fluctuations that occur during shipping.

Research has shown no significant degradation or loss of purity when lyophilized peptides are exposed to room temperature during typical shipping timeframes. Each batch is verified for purity upon production, and our stability testing confirms maintenance of product integrity during standard shipping conditions.

For optimal long-term storage after receiving your order, we recommend storing the lyophilized peptides in a cool, dry place until reconstitution is needed.

For bulk inquiries and volume pricing, please email us at info@peakpeptides.com

Related Products

Price range: $40.00 through $70.00

$120.00

Price range: $30.00 through $55.00